SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148274144|ref|YP_001223705.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148274144|ref|YP_001223705.1|
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.31e-22
Family Ribosomal protein L9 C-domain 0.00049
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily L9 N-domain-like 7.5e-16
Family Ribosomal protein L9 N-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148274144|ref|YP_001223705.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MSKVILTTEVSGLGSPGDVVEVKNGFSRNYLVPQGFAVIWSRGGEKQIEQIKAARAAREH
ATIEEAQDLKSRLEAKIVKLTVKAGQGGRLFGSVKTSDIAKAVEESGIGQVDKRKIEIPN
AIKATGNHEATIRLRDDIVATISLQVVAAK
Download sequence
Identical sequences A0A067LNN7 A0A0M3RRV4 A0A1Y3FGZ2 A0A251Y473 A5CVA8 M5BE34
gi|148274144|ref|YP_001223705.1| WP_012039647.1.100120 WP_012039647.1.11755 WP_012039647.1.14896 WP_012039647.1.27694 WP_012039647.1.31775 WP_012039647.1.36461 WP_012039647.1.38469 WP_012039647.1.56944 WP_012039647.1.57954 WP_012039647.1.64112 WP_012039647.1.69664 WP_012039647.1.71501 WP_012039647.1.75151 WP_012039647.1.80587 WP_012039647.1.8140 WP_012039647.1.81898 WP_012039647.1.84123 WP_012039647.1.88496 WP_012039647.1.97611 WP_012039647.1.97849 WP_012039647.1.98982 443906.CMM_2960 gi|473834859|ref|YP_007687157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]