SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117617787|ref|YP_856130.1| from Aeromonas hydrophila subsp. hydrophila ATCC 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117617787|ref|YP_856130.1|
Domain Number 1 Region: 9-155
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 3.27e-52
Family Molybdopterin synthase subunit MoaE 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117617787|ref|YP_856130.1|
Sequence length 157
Comment molybdopterin converting factor subunit 2 [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
Sequence
MSEATMTDRILVQRDDFSLADEYARLAARQDTGAVVSFVGKVRDFNQGEQVKGLALEHYP
GMTEKALTDIVAEARSRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMD
FLKTRAPFWKKELTAEGVQRWVEAKESDNTAAARWQA
Download sequence
Identical sequences A0KIM9
gi|117617787|ref|YP_856130.1| WP_011705489.1.100377 WP_011705489.1.12787 WP_011705489.1.34034 WP_011705489.1.34829 WP_011705489.1.48811 WP_011705489.1.56470 WP_011705489.1.62121 WP_011705489.1.64737 WP_011705489.1.64954 WP_011705489.1.65522 WP_011705489.1.81915 WP_011705489.1.95182 WP_011705489.1.97559 YP_856130.1.44769 380703.AHA_1594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]