SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117620483|ref|YP_856974.1| from Aeromonas hydrophila subsp. hydrophila ATCC 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117620483|ref|YP_856974.1|
Domain Number 1 Region: 6-316
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-42
Family FAD-linked reductases, N-terminal domain 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|117620483|ref|YP_856974.1|
Domain Number - Region: 447-526
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 0.000157
Family PA2201 C-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|117620483|ref|YP_856974.1|
Sequence length 559
Comment sn-glycerol-3-phosphate dehydrogenase subunit A [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
Sequence
MKRITTQVVIIGGGATGAGIMRDCALRGIDCILLERDDIAAGTTGRNHGLLHSGARYAVT
DQESARECIQENRILKRIASHCVEDTGGLFITLPEDDINFQNTFMDACALAGIDARQLDP
ADALRLEPNVNPALIGAIQVPDGTVDPFRLAAANVLDAKEHGARIFTHSKVLGLLRTQDR
VHGVKAINTRTGEAFEVECQEVINAAGIWGQQICEYADLGIRMFPAKGSLLIMDYRINQL
VLNRARKPADADILVPGDTISLIGTTSSRIDYHKIDQLTVEPEEVEVLLREGIKLAPIMA
RTRLLRAYAGVRPLVAVDGDESGRNISRGIVLLDHAERDGLKGFNTITGGKLMTYRLMAE
WATDLLAKKLGNSKPCRTAELSLPGSRDPEKVSAPGLSVPAEGSAQYRHGERVIAFFRDN
PKANALICECEMVTAGEIEYALRELDVDNLVDLRRRTRLGMGPCQGELCAYRAAGLMQEY
GKADGRQACVMLRQFLEERYKGTRPVLWGDALREAEFTYWIYEGLFGLGEWTAPHLVAEP
PFPLDANTANPTKERSHEI
Download sequence
Identical sequences A0KL23
WP_011706291.1.12787 YP_856974.1.44769 380703.AHA_2460 gi|117620483|ref|YP_856974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]