SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117621243|ref|YP_858383.1| from Aeromonas hydrophila subsp. hydrophila ATCC 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117621243|ref|YP_858383.1|
Domain Number 1 Region: 22-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.1e-95
Family Methylenetetrahydrofolate reductase 0.00000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117621243|ref|YP_858383.1|
Sequence length 298
Comment 5,10-methylenetetrahydrofolate reductase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
Sequence
MGFHSARQVEALNQSLADLSGDISVSFEFFPPNSEGMENTLWQSIERLKVLEPKFVSVTY
GANSGTRDRTHKVIKDIKERTGLIAAPHLTCIDASRDELRTIARDYWNSGIRHIVALRGD
LPQGLEKPEMYATDLVALLKAEADFDISVAAYPEGHPEARSAQSDLLNLKRKIDAGANRA
ITQFFFDVETYLRFRDRCAAIGIDAEIVPGILPVSNYQTLAKFAGFTNVKIPRWMHQRFE
GLDDDQMTRNMVGASIAIDQVRVLSQEGVKDFHFYTLNRSELTYAICHTLGVRPKGQP
Download sequence
Identical sequences A0A081UYA8 A0A1U6XUZ9 A0A249CSW9 A0KQ32 K1J5I9
WP_005306036.1.11394 WP_005306036.1.11585 WP_005306036.1.12326 WP_005306036.1.12787 WP_005306036.1.17591 WP_005306036.1.17828 WP_005306036.1.1904 WP_005306036.1.21213 WP_005306036.1.26014 WP_005306036.1.2747 WP_005306036.1.28436 WP_005306036.1.3157 WP_005306036.1.32895 WP_005306036.1.34034 WP_005306036.1.34398 WP_005306036.1.34829 WP_005306036.1.4153 WP_005306036.1.41987 WP_005306036.1.43483 WP_005306036.1.44246 WP_005306036.1.45454 WP_005306036.1.48145 WP_005306036.1.48639 WP_005306036.1.51461 WP_005306036.1.51574 WP_005306036.1.51862 WP_005306036.1.52677 WP_005306036.1.5367 WP_005306036.1.56245 WP_005306036.1.56470 WP_005306036.1.60185 WP_005306036.1.61841 WP_005306036.1.62064 WP_005306036.1.62309 WP_005306036.1.62601 WP_005306036.1.62729 WP_005306036.1.64737 WP_005306036.1.64954 WP_005306036.1.6571 WP_005306036.1.66799 WP_005306036.1.67280 WP_005306036.1.69299 WP_005306036.1.77035 WP_005306036.1.9133 WP_005306036.1.93440 WP_005306036.1.93930 WP_005306036.1.94363 WP_005306036.1.95182 WP_005306036.1.96790 WP_005306036.1.99242 YP_858383.1.44769 380703.AHA_3949 gi|117621243|ref|YP_858383.1| gi|507523668|ref|YP_008045282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]