SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117619572|ref|YP_856212.1| from Aeromonas hydrophila subsp. hydrophila ATCC 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117619572|ref|YP_856212.1|
Domain Number 1 Region: 293-434
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000323
Family Tetratricopeptide repeat (TPR) 0.09
Further Details:      
 
Weak hits

Sequence:  gi|117619572|ref|YP_856212.1|
Domain Number - Region: 227-318
Classification Level Classification E-value
Superfamily Bacterial muramidases 0.0209
Family Bacterial muramidases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117619572|ref|YP_856212.1|
Sequence length 467
Comment zinc metalloprotease [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
Sequence
MGATFHAQANNQLPDIGTAGVAALPIEQEVRYGNAFMRFARAGLPIIDDPVLSQYIDDLG
QRLLSNADGVRFPFTFFLINDPSINAAAFLGGRVKVHTGLFLYADSESELASVLAHEITH
VTQRHIARYMEAQASSSAMTLAGLVGSIALAVINPTAGIAALQTTLGLSMQSAINYTRDN
EYEADRIGMKTLYDAGFDPMGMANFFQKLAAEYRYASKPPEMLLTHPLPETRISEARARA
GSYGRRDLPPSLDFWLAKVRIQVRFGTESPQALLTYFDNRLQKGDYPLKDAATYGKALAL
LQLKRTDEADALMQELATRHPEDLFVVDALTDIDLAKGRSAQAIARLEKFRTRMPDNEVV
VVNLGNAYLEGGNYKKSIAILDPYAREHEENNLAWSLLSDAYRKAGRMTDLHMARAEMLS
LRGDYQAAIDELIVARGTTNDKLTLARLEARITELERAKKDLDSLKG
Download sequence
Identical sequences A0A1V2F024 A0KIW1
gi|117619572|ref|YP_856212.1| WP_011705566.1.100377 WP_011705566.1.11585 WP_011705566.1.12787 WP_011705566.1.13401 WP_011705566.1.17591 WP_011705566.1.17828 WP_011705566.1.1904 WP_011705566.1.2747 WP_011705566.1.28436 WP_011705566.1.34034 WP_011705566.1.34398 WP_011705566.1.34829 WP_011705566.1.38175 WP_011705566.1.4153 WP_011705566.1.41987 WP_011705566.1.44246 WP_011705566.1.48639 WP_011705566.1.48811 WP_011705566.1.51862 WP_011705566.1.5367 WP_011705566.1.56245 WP_011705566.1.56470 WP_011705566.1.60150 WP_011705566.1.61841 WP_011705566.1.62064 WP_011705566.1.62121 WP_011705566.1.62309 WP_011705566.1.62601 WP_011705566.1.62729 WP_011705566.1.64954 WP_011705566.1.65522 WP_011705566.1.6571 WP_011705566.1.67280 WP_011705566.1.69299 WP_011705566.1.81915 WP_011705566.1.9133 WP_011705566.1.93440 WP_011705566.1.93930 WP_011705566.1.94363 WP_011705566.1.95182 WP_011705566.1.97559 YP_856212.1.44769 380703.AHA_1676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]