SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117620024|ref|YP_856984.1| from Aeromonas hydrophila subsp. hydrophila ATCC 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117620024|ref|YP_856984.1|
Domain Number 1 Region: 269-375
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000548
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117620024|ref|YP_856984.1|
Sequence length 396
Comment formate-dependent nitrite reductase complex subunit NrfF [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
Sequence
MSRLGHAHIAPLLLALSLGALASGVDTYEFRHPERQTRAQELARALRCPQCQNQNLVESN
SPIARDLRLEVYRWVDEGQSDEQVIARMTERFGDFVRYDPPFKLSTALLWGGPALLLLLA
LNRLRRSLHRRQPARVPLIGDRAEGALTHDPRAELNRLIMAKQQAGLASTSRLYRELELA
RLANATPTAEQVLRERLAKDRAARPLPWLRSWILLGALLLALMAGIYAGTGRYQAWQAYQ
SRPDPLAGLSPRDLQDKELGALHQRLQTNPADLDGWAALGQLYLYRDEYANALLAYQRLA
LQEGGASAATQAAQATVLYYQAGQQLTPEALRLLDSALKQDKGEVSALMLLASDHFLHGR
YSQAIALWQQLLDEERPRINRAALIEAIQTARMMGG
Download sequence
Identical sequences A0KL33
WP_011706301.1.12787 YP_856984.1.44769 380703.AHA_2470 gi|117620024|ref|YP_856984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]