SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117621176|ref|YP_854999.1| from Aeromonas hydrophila subsp. hydrophila ATCC 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117621176|ref|YP_854999.1|
Domain Number 1 Region: 144-301,329-384
Classification Level Classification E-value
Superfamily TPR-like 0.000000111
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117621176|ref|YP_854999.1|
Sequence length 387
Comment HemY protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
Sequence
MIRLIVLVAAMVAGLIFGPQASGNKGYVLISLGNYTVESSVTSAVILAVLFYGALLIVEW
LLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQAEKLMLKGASNSDTPLLN
YLSAAKAAQARGDDVRRDQYLQKAQEENPKAELALTLTQTQLQIEQGQYDTALAMLESVY
ALNPRHPMVLDQLRQVHLAREDWAALIDLIPVLHKVGKLTPKQEEDLLQQAWRGRLDAAS
GALETLRPIWQELPRKLRQDPDLLAAYGDRLRQLGADNEAAELWLDALRKQVSPQLLARL
PKLKLDSYQPMLTLLQKIQDQPGVDAALAQVYLLAGQLDDAQRLLEQEVAKAPNAAVYHA
LGQVMDKRRLTNKANEYYRQALQLADV
Download sequence
Identical sequences A0A1C2L4B2 A0A1N6W4G3 A0KFH3
380703.AHA_0466 gi|117621176|ref|YP_854999.1| WP_011704439.1.12787 WP_011704439.1.13401 WP_011704439.1.28436 WP_011704439.1.34034 WP_011704439.1.38175 WP_011704439.1.41987 WP_011704439.1.56470 WP_011704439.1.60150 WP_011704439.1.62309 WP_011704439.1.67280 YP_854999.1.44769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]