SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117621452|ref|YP_856039.1| from Aeromonas hydrophila subsp. hydrophila ATCC 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117621452|ref|YP_856039.1|
Domain Number 1 Region: 447-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117621452|ref|YP_856039.1|
Sequence length 607
Comment sulfate permease [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
Sequence
MRDFFSLERWLPGLAALLQYQRAWLMPDMRAGLSVAAVALPVAIAYAELAGVGPLVGLYS
CILPMLVYALFGTSRQLIVGPDAATCAVIAAVVTPLAAGDATRHWQLVMTMTAMTGFWCL
IASRFKLGVLADFLSRPILMGLLNGVAITIMVGQLSKIFGFTFSERYLIERIAGGASYIT
QTHLPTLAMSLTALLTLLLAKRFKPAWPSSMVAMVVTAGLVWALDLGQFGIATLGAIGSG
LPAFQLPEFPPGLMRELVLPALNLAMVSFVSMMLTARSFAAKNGYEIDADKEFRALGMAN
LAAAASQGFAISGADSRTAVNDANGGKSQLVSIIAAAVIALVTFYLTAPLQYIPTAALGV
VLVMASLSLTDFRGLWALRHSDRSAFWLALITFISVLAMGVIPGITLAVLLGLFQFLRNV
MRPTDQLLGMDDEGVVRTLGDNEQAKAIPGILVYRFNSPLTYFNAPYFKRRVLALLVQDP
HSPKCLVVDAVACFTHQDISVMSMLGELHKDLKRRGIHMVMAGRHGQMSLWLKQAGIRVG
DEGIILCPDMYQALRMTRCYREPVFKDDEVVESTTEAILSRWPQDDALPDSARLTLPSEQ
EAGATPA
Download sequence
Identical sequences A0A2K0KXF6 A0KID8
380703.AHA_1501 WP_011705399.1.100377 WP_011705399.1.12787 WP_011705399.1.34034 WP_011705399.1.34829 WP_011705399.1.44246 WP_011705399.1.48639 WP_011705399.1.64737 WP_011705399.1.77035 WP_011705399.1.93930 YP_856039.1.44769 gi|117621452|ref|YP_856039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]