SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119871796|ref|YP_929803.1| from Pyrobaculum islandicum DSM 4184

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119871796|ref|YP_929803.1|
Domain Number 1 Region: 15-404
Classification Level Classification E-value
Superfamily L-aspartase-like 4.24e-81
Family L-aspartase/fumarase 0.00000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119871796|ref|YP_929803.1|
Sequence length 429
Comment argininosuccinate lyase [Pyrobaculum islandicum DSM 4184]
Sequence
MSFYRSWIGEEGELIKRYTSSIKDDVEIAEEVIKVMEAHVKHLAEVGIMPKEAADAILKT
LKEATPEQLLSSEFEDIHEALEKWLIDRLGEETAGWVGLGRSRNDHVAAAIRLAALRKAS
ALRKNVEKMRCILAKKALEYADCAMPSFTHFQPAQAITFGHYLLAVDELAAEFLHVLKAV
EKLLKRSPLGAGPAGGTRTPIDRERLAKLAGFEDVVENALYASGSRFFALALASAVVSFL
TELSRTVDDLIRWNSPLVGYVAAPDSHVSTSSIMPHKRNLVTLEVFRARAAEALGHLTAL
NAVVMKIGLGYSLDLQEATRHLWAVLNMATEGVEIFIDFLEKMSFNCVKAREDAERYHST
SSDTAETIALSGVPFRKAYFQLAKEIKEGTARLMSIEEALQRPTRGSANPEEVKKAASTR
LVFCREKPL
Download sequence
Identical sequences A1RR78
384616.Pisl_0281 gi|119871796|ref|YP_929803.1| WP_011762037.1.84334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]