SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119872472|ref|YP_930479.1| from Pyrobaculum islandicum DSM 4184

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119872472|ref|YP_930479.1|
Domain Number 1 Region: 167-284
Classification Level Classification E-value
Superfamily DNA primase core 0.000000000102
Family DNA primase DnaG catalytic core 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119872472|ref|YP_930479.1|
Sequence length 405
Comment DNA primase [Pyrobaculum islandicum DSM 4184]
Sequence
MGALTIVAKYMIVAQIEVNGSVDKSDIIGALFSQTEGLLGKDMDLRELQMMGRIGRIEVE
ISEKNSKTKARIYIPSNLDRYETALVAALIESVERVGPYLASVKVLEIKDLREEKRRKII
ERAKELVKLIEEEILPDTKEIIERLKEDVAKAEIIEYGPEKLPAGPDVDKSDSIIVVEGR
ADVVNLVKHGYRNVIAIEGISKGVPQTIIDLSKKKSVTVFIDGDKGGEIVLRELIKVAHI
DYIARAPPGKEVEQLTAKEIAKALRNKITLEEWLAQQKAAGEKTESQMSPQQPQLTQTQP
TTAEVQAPFDLSKKIEEMLGTLEAEIYDANWTLLKRLPVRELPDFLANSNDSIYAVVMDG
IVTQRIVDLATKRGVKVIITARVGPLTKVPEDMKIVTFDQITQKT
Download sequence
Identical sequences A1RT54
gi|119872472|ref|YP_930479.1| WP_011762711.1.84334 384616.Pisl_0960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]