SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119872700|ref|YP_930707.1| from Pyrobaculum islandicum DSM 4184

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119872700|ref|YP_930707.1|
Domain Number 1 Region: 2-395
Classification Level Classification E-value
Superfamily L-aspartase-like 1.88e-101
Family L-aspartase/fumarase 0.00000000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119872700|ref|YP_930707.1|
Sequence length 403
Comment adenylosuccinate lyase [Pyrobaculum islandicum DSM 4184]
Sequence
MISPFDWRYGSEEIRALFTPQSFIDTYIEVERALVCVLEELGVAERGCCKSLDGVKISAE
EVYKLERETGHDILSLVFLLEQKSGCRFVHYGATSNDIIDTAWALLIRRALSIVKRKLDI
AGEELKRLARRYKKLVMVGRTHGQWAEPITLGFKFANYYYELYMACRFLTQAEDFIRAKI
GGAVGTMAAWGELGLEIRRRVAERLGLPYHIITTQVAPRESFAALASALAVLATVFERLA
TEIRELSRPEIGEVIERGGGSSAMPHKTNPTVSERVVSLARYVRSLIDVALENVALWHER
DLTNSANERVWIPEVFLAIDEILNSVAKVLRNIEINEARIEENLQKALPYILTEFHMNRL
VREGFSRAEAYRRAREIKEVTFEYERWPIEKLIEDALSLKLCG
Download sequence
Identical sequences A1RTT2
gi|119872700|ref|YP_930707.1| 384616.Pisl_1197 WP_011762939.1.84334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]