SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119873130|ref|YP_931137.1| from Pyrobaculum islandicum DSM 4184

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119873130|ref|YP_931137.1|
Domain Number 1 Region: 206-455
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.13e-67
Family Leukotriene A4 hydrolase catalytic domain 0.00042
Further Details:      
 
Domain Number 2 Region: 23-196
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 4.58e-32
Family Leukotriene A4 hydrolase N-terminal domain 0.00091
Further Details:      
 
Domain Number 3 Region: 533-792
Classification Level Classification E-value
Superfamily ARM repeat 1.6e-23
Family PBS lyase HEAT-like repeat 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119873130|ref|YP_931137.1|
Sequence length 821
Comment peptidase M1, membrane alanine aminopeptidase [Pyrobaculum islandicum DSM 4184]
Sequence
MKYLIGRDFAFPEYMPRFPPFYEFDILKMYLNITINIEQRAVEGLVKYRVKAKKDSAKVL
LDAVEIDLLDVSHEFYYDGEKIEIRPQWKAGEVVEVAVKYRARPRAGMYFVTPHGQRRSV
YVWTQGESEYNRYWVPLPDSPNIKFPWTVAVTVPKPLVAGSNGLLVEIKEGEDSRTYVWE
MRHPMSPYLLAIAAGDFEIYSEKCGEVLLEYYIPRYIGGEWRYSFYNTCDIMRFFSEYLG
VPYPYERYAQVVVPEFIYGGMENTTFTILTDWTIHDKHAHCPYGEFPCPGQEDFSSDPLV
AHEMAHMWFGDLVTAKDWGHIAINESFATFIEALWTERSKGREEYLYEIYTNFKTYLGEY
SRRYSRPIVTNVYKIPDEVFDRHAYEKGSVVLHMLRSLLGDDVFRRGLKVFLERNRYRAV
DIEDLRKALEEAAGRDLEWFWRQFFYSAGHPVLKISWNYSDGVIKLQIKQTQGEDSYPVY
TLPLEIKIVYEDGKRETREIMLDEKEATLHISGGKPRYICIDPAFKVMKALDLQYPLESA
IAMLDDEDFYCRIQAVEVLKKNGSVKAVDALARALQDKFWGVATEAAKALGEIGTAYAVT
KLIESYHIVSHPRVRRAIVEALGSSRRKEAAEFLDKILHNQNESYYVRAEAARALGKIKW
EFAEHSLKRALEYTSHLDVIKRGALEGLAELGTDDALKIVLRHTELDMPTYVRVTAVQSL
AKFGPRREVLETIRAALRDENFRVRYAAVTAALELLDQRLIPDLQERMERDVDGRIRRVA
REVIEKIKRAMERGAEYQKLREEVEKLRDEYRKLLDRIGKH
Download sequence
Identical sequences A1RV12
gi|119873130|ref|YP_931137.1| 384616.Pisl_1642 WP_011763369.1.84334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]