SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119873397|ref|YP_931404.1| from Pyrobaculum islandicum DSM 4184

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119873397|ref|YP_931404.1|
Domain Number 1 Region: 20-416
Classification Level Classification E-value
Superfamily ADC synthase 1.83e-121
Family ADC synthase 0.0000000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119873397|ref|YP_931404.1|
Sequence length 422
Comment anthranilate synthase [Pyrobaculum islandicum DSM 4184]
Sequence
MKIPLSKLPPPRELAHGLYQSGEEFVALLESGQGFAERARFTLVAWGVERAYVSSGPDLQ
QVLYLAQRELKADGGPFGGDVLIGALTYEASYYMEPLLLRYNKVDRSIPAAFLVKPRGYI
LYDKMLGRGYLRGEMPKVSVERRETKVRGPVAMTDPNRFKSWVAEGRERIAAGEILQVVL
SRWVDYRAEGDLFPLYKALAEENPSPYMYFVKYGDIHLIGTSPELLVKVQSGRVETHPIA
GTRPRGATEEEDLALEEDMLSDEKELAEHIMLVDLARNDIGRVCQLGSVKVEELFAVEKY
SRVQHIVSRVMGVMDRRFTPVDALLATHPAGTVSGAPKVRAMEIIAELEDEPRRFYAGAV
GFISPSLLEFAIVIRTIVAMGDSLRIQAGAGVVYDSTPEREFRETESKLAALRAVVEGGP
WT
Download sequence
Identical sequences A1RVS9
WP_011763636.1.84334 gi|119873397|ref|YP_931404.1| 384616.Pisl_1914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]