SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118475343|ref|YP_891475.1| from Campylobacter fetus subsp. fetus 82-40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118475343|ref|YP_891475.1|
Domain Number 1 Region: 11-267
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.22e-78
Family Alanine racemase-like, N-terminal domain 0.00000576
Further Details:      
 
Domain Number 2 Region: 242-399
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.93e-54
Family Eukaryotic ODC-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118475343|ref|YP_891475.1|
Sequence length 403
Comment diaminopimelate decarboxylase [Campylobacter fetus subsp. fetus 82-40]
Sequence
MDYSLLAKKYGTPLYAYDFDYIQNQYNKLKKEFNARKSLICYALKANSNLSLLKHIADLG
AGFDCVSIGEVKKAILAGAQNYKIIYSGVGKSDEEIEEALNLDILMLNLESEEEMKRVES
IAKKLNKKARISVRVNPNVDPKTHPYISTGLSKNKFGVGIEKARKMYLYAHKSEFLDPVG
IHFHIGSQLTDLKPVIEAANIVSDLLRELKALDIDIKFFDVGGGIGIRYENEKDPDLYGY
AQGILAALKGEDITIICEPGRFLVGNAGVFITKVLYEKINDTHSDDKKRFIIVDGAMNDL
LRPSLYEAHHEIIALNSGKKELCDVVGPICESGDFLGKNVNLPKQSSGDILVVKSAGAYG
FCMSSNYNSRLRTAEVAVCGGKDRLIRQRESFEDLVKNEKEFI
Download sequence
Identical sequences A0RMP2
gi|118475343|ref|YP_891475.1| WP_011731761.1.16919 WP_011731761.1.40084 WP_011731761.1.63275 WP_011731761.1.77129 360106.CFF8240_0271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]