SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118475146|ref|YP_891540.1| from Campylobacter fetus subsp. fetus 82-40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118475146|ref|YP_891540.1|
Domain Number 1 Region: 15-245
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.51e-41
Family Alanine racemase-like, N-terminal domain 0.0081
Further Details:      
 
Domain Number 2 Region: 212-367
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.91e-28
Family Eukaryotic ODC-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118475146|ref|YP_891540.1|
Sequence length 377
Comment carboxynorspermidine decarboxylase [Campylobacter fetus subsp. fetus 82-40]
Sequence
MKLNDIKTPAYVCEEAALENNLKILKNISDESGAKVLCALKGFAFSGAMELVSKYLNGAT
CSGLHEAKYAKYHGFKEIHTYSPAFSDDDIDEVLSISHHVVFNSFAQWNKFRSKSIKSGK
SIGLRVNPNTSASPTDMYNPCGEFSRLGITKDNFDFSNLDGVEGLHFHALCEESAKSLEF
VLKAFEEQFRTIIPKMKWINFGGGHHITKSGYDINLLINLIKSFKEKYGTQIFIEPGEAV
GWRCGFLISSVLDIVTNGEKTCIIDASAECHMPDTILMPYRPSIRGENKNGKFAYRFGGA
TCLAGDIVGAAAGEPIFKFDNEIKVGDKVIFEDQIHYTIVKNTTFNGVKLPNLVMMNKNG
DVKIIRDFGYDEYSRRN
Download sequence
Identical sequences A0RMV7 W0D8V9
WP_002848463.1.1289 WP_002848463.1.1469 WP_002848463.1.16919 WP_002848463.1.17016 WP_002848463.1.36062 WP_002848463.1.38168 WP_002848463.1.39057 WP_002848463.1.41035 WP_002848463.1.42882 WP_002848463.1.44411 WP_002848463.1.46075 WP_002848463.1.46714 WP_002848463.1.48558 WP_002848463.1.51765 WP_002848463.1.5603 WP_002848463.1.59303 WP_002848463.1.60351 WP_002848463.1.62614 WP_002848463.1.63275 WP_002848463.1.68475 WP_002848463.1.71429 WP_002848463.1.74407 WP_002848463.1.77394 WP_002848463.1.81562 360106.CFF8240_0338 gi|118475146|ref|YP_891540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]