SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126444597|ref|YP_001062594.1| from Burkholderia pseudomallei 668

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126444597|ref|YP_001062594.1|
Domain Number 1 Region: 3-367
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.07e-108
Family FMN-linked oxidoreductases 0.00000000146
Further Details:      
 
Domain Number 2 Region: 334-523
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.65e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000556
Further Details:      
 
Domain Number 3 Region: 463-521,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.97e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126444597|ref|YP_001062594.1|
Sequence length 673
Comment FAD/FMN-binding/pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia pseudomallei 668]
Sequence
MTFYPHLTAPLELGFTSLKNRVLMGSMHVGLEEAANGFERMAAFYAERARGEAGLIVTGG
IAPNERGRMMPGGSMLATEEEAERHRIVTRAVHDAGGRIAMQILHFGRYAYHPALVAPSA
LKAPINTFTPHALSASEVDATIDDFARCAALAQYAGYDGVEIMGSEGYLINEFIAAHTNH
REDEWGGAYENRIRFPVEIVRRVRERVGTNFIIIYRLSMLDLVEGGSTLDEVIRLAQAIE
AAGATILNTGIGWHEARIPTIATKVPRAAYAWVTKRLVGRVGIPLVATNRINTPEIAEQL
LAEGYCDMVSMARPFLADAQFVRKAREGRADEINTCIGCNQACLDHIFSGRITSCLVNPR
ACHETELVIEPAERRKRIAVVGAGPAGLSFAVTAAERGHDVELFEASPEIGGQFNIAKKV
PGKEEFHETLRYFRRQLELRGVTLHLNTRADVARLAGGGFDEIVLATGVTPRRPDIEGIG
HARVMGYLDVLRDGKPVGASVAVIGAGGIGFDVSEYLTHTGESASVAPSTFYAQWGIDVD
YGARGGVRMPHVEAAPRNVHLLQRKASKVGDGLGKTTGWIHRTSLKARRVAMSSGVSYER
IDDAGLHVRIDGEPRTLAVDSVVVCAGQEPQRELYDGLRAAGCSVHLIGGAHVAAELDAK
RAILQGTTLAASI
Download sequence
Identical sequences A3NJS3
WP_011853184.1.1465 WP_011853184.1.21409 WP_011853184.1.32581 WP_011853184.1.45356 WP_011853184.1.52882 WP_011853184.1.53386 WP_011853184.1.58105 WP_011853184.1.58639 WP_011853184.1.70096 WP_011853184.1.76575 WP_011853184.1.86872 gi|126444597|ref|YP_001062594.1| 320373.BURPS668_A1598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]