SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126438998|ref|YP_001057795.1| from Burkholderia pseudomallei 668

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126438998|ref|YP_001057795.1|
Domain Number 1 Region: 156-291,320-400,440-461
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.25e-46
Family Purple acid phosphatase-like 0.0013
Further Details:      
 
Domain Number 2 Region: 40-151
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 1.31e-22
Family Purple acid phosphatase, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126438998|ref|YP_001057795.1|
Sequence length 560
Comment Ser/Thr protein phosphatase [Burkholderia pseudomallei 668]
Sequence
MSNKPAPDAPPAEQPCAVSRRGFLKFAGVSGLASAASSLAATRAAAAAPDGTPEQIHLTW
GDADANEVVVSWASLAAATNPRVRFAGPNEAWRTVHGVQRTYTDGLNGEVVFTYHARLRG
LKPGAVYRYEVTADNDANAAQPFAARFETAPRGRAPFRWTSYGDLATPNTGWVLSSPQSR
FAVQAVERFQPLFHLLNGDLCYANLNPAHQPAVWRDFGNNNQTSAANRPWMPCPGNHEIE
FHNGAQGLDSYLARYTLPENGTRFAGRWYSFRVGAVLFVSLDADDVVYQDAAAFVAGPNP
LVPAASTGNEAIAPGTSLYVRGYSRGEQTRWLEQTLRRASRDRDIDWIVVQMHQDALSSS
KTGNGSDKGIREAWLPLFDRYGVDLVLCGHDHDYERSFPVRGCNHRAGVDAATGEVVDTL
QPRPVVTTDPADGRFDTSHGTIHMILGGGGTSAPLDVYGENPATGLPQARVFTKPNRPVP
GAAPNTFVRHGADAVEDAIWSARRDTGTGYGIAVFDYEPGEHGGRSTITVNYYHAPGADQ
HPTAEYELFETIVLSKPRRA
Download sequence
Identical sequences A3N624
WP_011851117.1.21653 WP_011851117.1.45356 WP_011851117.1.52882 WP_011851117.1.75708 320373.BURPS668_0744 gi|126438998|ref|YP_001057795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]