SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110636573|ref|YP_676780.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110636573|ref|YP_676780.1|
Domain Number 1 Region: 258-556
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.71e-83
Family DNA repair protein MutS, domain III 0.00000306
Further Details:      
 
Domain Number 2 Region: 557-793
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-56
Family ABC transporter ATPase domain-like 0.00000102
Further Details:      
 
Domain Number 3 Region: 104-257
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 7.59e-37
Family DNA repair protein MutS, domain II 0.00059
Further Details:      
 
Domain Number 4 Region: 1-103
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.75e-35
Family DNA repair protein MutS, domain I 0.000072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110636573|ref|YP_676780.1|
Sequence length 856
Comment DNA mismatch repair protein MutS [Cytophaga hutchinsonii ATCC 33406]
Sequence
MKQYNAIKGKYPGALLLFRVGDFYETFSEDAIKASKVLGITLTKRGNGTASETALAGFPH
HSLDTYLPRLVRSGLRVAICDQLEDPKSVKGIVKRGVTELVTPGVSFNDHVLDVSKNNYL
AAIHFQKDSLGISFLDISTGEFLTAQGDRHYIDKLLQSFSPSEVLFCKQKKEVFIEYFGD
RYNTYALEDWIFAYDFTYDLLIRHFQTTSLKGFGIEEMLEGITSAGAILHYLNETEHKEV
AHITRVNRIEEERYVWLDRFTIRNLELVNAQQLEGVPLIEILDHTKTPMGARLLKKWLIL
PLKELTPIQERLDTVELLVKNKELTTTLVDELKPIGDLERLISKVAARRVNPREMVQLKR
SLERLVPIQQLLKQQDQHVLLKLAEQINPCEYLAGRILNMLKEDAPMLTNQGRIIRDGCN
AELDELRAIAYTGKDYLLQIQQREIERTGISSLKISYNKVFGYYLEVTNTHKEKVPADWI
RKQTLTGAERYITEELKIYEEKILGAEDKINVIEQKMFQDLVLEAESYINPILQNARIVA
QIDCLCSFAHAAVANNYCKPIVEDSALINIKAGRHPVIEKQLPLGESYIPNDIYLDDETQ
QVMIITGPNMAGKSALLRQTALIVLMAQAGSFVPATHATIGTVDKVFTRVGASDNLSKGE
STFMVEMNETASILNNLSGRSLVLMDEIGRGTSTYDGISIAWAIVEHLHNHPNFRPKTLF
ATHYHELNQLTEDLKRVKNFNVSVKEAGNKVIFMRTLKPGGSEHSFGIHVAQMAGMPTSL
VLRANEIMGHLEKEHVREGHEDKLKEVPKSTLQMSLFEAADPAWDSIKKILTQTDVNIMS
PVEALLKLNELKQLIK
Download sequence
Identical sequences Q11YS6
269798.CHU_0147 ChR137 WP_011583556.1.19587 WP_011583556.1.79486 gi|110636573|ref|YP_676780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]