SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110637335|ref|YP_677542.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110637335|ref|YP_677542.1|
Domain Number 1 Region: 46-105
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000837
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|110637335|ref|YP_677542.1|
Domain Number - Region: 183-211
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00249
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 114-177
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110637335|ref|YP_677542.1|
Sequence length 258
Comment hypothetical protein CHU_0923 [Cytophaga hutchinsonii ATCC 33406]
Sequence
MKLFKADSLKSVFIHAGIIVSIFVGLILIFFYWYLPSVTKHGEYISVPKLEGLSISQVEQ
KLNDLGLRYEISDSTFKPGITPLTVLTQHPLPGNEVKENRRIYLSIAAQHPPNIKMPKLI
DESPRGAEMILKSLGLQMGEIKTAPHPYPTVLGQFINGAPVKEGTSIPKGSKIDLLVGTG
RGETDVEIPNLVNMSLDEAKSTISSMGLVVGLVNYDTNSKLAEGTVCNQKPAYQSGQKLR
SGDIIDLVVAGSDPVIPQ
Download sequence
Identical sequences Q11WL4
gi|110637335|ref|YP_677542.1| 269798.CHU_0923 WP_011584317.1.19587 WP_011584317.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]