SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110637663|ref|YP_677870.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110637663|ref|YP_677870.1|
Domain Number 1 Region: 2-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.15e-54
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110637663|ref|YP_677870.1|
Sequence length 250
Comment branched-chain amino acid ABC transporter ATP-binding protein [Cytophaga hutchinsonii ATCC 33406]
Sequence
MLLNVKNLHVSFGGVKALNLSAFNIQQNELRVIIGPNGAGKSTFMDILCGKTKPNGGDVT
FNGEEILGKKEVRIAQMGIGRKFQKPSVFPSLSVFDNMLLSVRMHKGLLTSMFFKMNTEI
KDRIESVAEMVGLGKHLELLAGNLSHGQKQWLEIAIVILQDPKLMLIDEPAAGMSDEETY
KTGELLTNLSKKHSVIVIEHDMGFVKQIAQNLVTVLVRGQLLMEGSFDQVRNDERVIDSY
LGRANTALEK
Download sequence
Identical sequences Q11VN6
269798.CHU_1258 WP_011584645.1.19587 WP_011584645.1.79486 gi|110637663|ref|YP_677870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]