SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110637737|ref|YP_677944.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110637737|ref|YP_677944.1|
Domain Number 1 Region: 634-807
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.49e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 3-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0022
Further Details:      
 
Domain Number 3 Region: 150-309
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0081
Further Details:      
 
Domain Number 4 Region: 505-642
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.74e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110637737|ref|YP_677944.1|
Sequence length 837
Comment assimilatory nitrite reductase (NAD(P)H) large subunit [Cytophaga hutchinsonii ATCC 33406]
Sequence
MKNETHILVVGNGMVGYKFCEKLKKKDSSGNFTITVLGEEPRPAYDRVHLSEYFSTRSAD
HLTMAPKEWYAANNINLVLGNPVVSIDREQKSVTTFSGAVYTYDKLILATGSAAFVPPIK
GVEKDGIFVYRTIEDLEMMIKQAEKSKVGAVIGGGLLGLEAAKALLDLGLKPHVIEFAPR
LMPRQLDEAGSKILQQKLESLGLSIHLNKTTSYFDGDAAVTAMQFADDTRLELDMVVISA
GIKPRDEIAKKAGLTVGPRGGIEVNDALQTSDPNIYAIGECALHWGMIYGLVAPGYEMAE
VVAENLIHEHSKAFRSFDMSTKLKLIGVDVASFGDAFGTEEGSVTITYENKDKGIYKRLN
LSADKKRVIGGILVGDAESYNMLLQMVTNKMALPPDPEDLILGSRGEGRSEGGNAGVMSL
PDEALICSCEGVTKGMICCAVTDQHVTDLPGMKKCTKAGTGCGGCVPMVNDLISETLKSQ
GKVIKKVLCEHFDYSRQELLDLIKINEYKSYDVILNEAGKGDGCEICKPAIGSILASVWN
EVILKQATIQDSNDRFLANLQKGGTYSVVPRVAGGEITADKLIVLGEVAKKYDLYCKITG
GQRIDLFGAPVHQLPDIWEELIHAGFESGHAYGKSLRTVKSCVGSTWCRFGVQDAVSYAI
RIEDRYKGIRSPHKVKMAVSGCVRECAEAQSKDFGIIATDKGWNLYVCGNGGAKPQHALL
FASDLDDETCIRYIDRIMIFYIRTAEPLMRTATWLNKLEGGMDYLRDVIINDSLGMCSQF
EKELQLLVDTYHCEWKEVVENPELRKRFNTFINSEEADETMAFVEMRTQKKPANWKA
Download sequence
Identical sequences Q11VG2
APC62820.0 269798.CHU_1332 gi|110637737|ref|YP_677944.1| WP_011584719.1.19587 WP_011584719.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]