SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110638202|ref|YP_678411.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|110638202|ref|YP_678411.1|
Domain Number - Region: 6-125
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00759
Family DNA repair protein MutS, domain III 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110638202|ref|YP_678411.1|
Sequence length 158
Comment hypothetical protein CHU_1802 [Cytophaga hutchinsonii ATCC 33406]
Sequence
MKAASLSELKKELQNRSSKELVEICLRLAKFKKESKELLTYLIFESESEANYIAAIKADM
DEQFELLNTSNLYVAKKGLQKIVRSIAKYIKYSGIKQTEIEVLVYFCRHMKKSGIKITHS
TVIENLYQRQINKIEKALNSLHEDLQFDYQQEVEQLYL
Download sequence
Identical sequences Q11U45
269798.CHU_1802 gi|110638202|ref|YP_678411.1| WP_011585186.1.19587 WP_011585186.1.79486 2005359266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]