SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110639022|ref|YP_679231.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110639022|ref|YP_679231.1|
Domain Number 1 Region: 131-284
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.45e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00048
Further Details:      
 
Domain Number 2 Region: 406-543
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.22e-28
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 28-130
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.34e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0071
Further Details:      
 
Domain Number 4 Region: 266-290,319-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.64e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110639022|ref|YP_679231.1|
Sequence length 713
Comment sulfite reductase (NADPH) [Cytophaga hutchinsonii ATCC 33406]
Sequence
MSNNTQETAGFNFAPQVSAAAQADIVELSTKIKGFRDNTIDSEKFRSFRLTRGVYGQRQE
GVQMIRIKLPYGKVTTDQIIRIADISDKYGSSNLHLTTRQDIQLHYVKLENAPLVWNELE
EVGVTLREACGNAVRNITASYTAGVDPNEPFDVSPYAHSMFEYFLRNPICQDMGRKFKIS
FSTSEADTAFGFIHDLGFIPRVKTVNGKEVRGFKVLLAGGLGAQPFVAHNVHEFLEEDQL
IPFSTAVIRVFDRFGERSKRHKARLKYLVNGIGVEAFMEHVAKERIAIKDKSVVIDRNRV
DEIILPAVTSFTEATPVDAVKFERFVKANVFEQKQKGYFGVQLKQHLGDLKSDKARVFAA
IVKKYASDDVRITVNQGWLLKFVKKEALPALFNELNEIGLAEPGFDSMADITACPGTDTC
NLGISSSTGLSVEIEKMLLEEFPDTVFNKNIKIKISGCMNACGQHTIGNIGFHGMSIKNG
TNVLPAMQVMLGGGLEPDGTGTIADKILKLPTRRCVEAVREILTDYDTNATEGEYFNDYY
RRQVAAEKMYFYKLLKPLSDLETLTELDYIDLGHDEKYVTEVGVGECAGVMIDLVGTLIL
DTEEKLKWSKRLQQNATPADAIYAAYATYVCGAKAILTGEGVACNTQIAMINDFDKHLVS
TNKFSIAGGSFASQVLCMSEHEPTKEFADKYIADTEQFVQQIKTYRAAALVTV
Download sequence
Identical sequences Q11RS5
269798.CHU_2637 WP_011585999.1.19587 WP_011585999.1.79486 gi|110639022|ref|YP_679231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]