SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110639033|ref|YP_679242.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110639033|ref|YP_679242.1|
Domain Number 1 Region: 294-522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.72e-37
Family ABC transporter ATPase domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 36-291
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.35e-19
Family DNA repair protein MutS, domain III 0.017
Further Details:      
 
Domain Number 3 Region: 719-793
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000353
Family Smr domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110639033|ref|YP_679242.1|
Sequence length 797
Comment DNA-mismatch repair protein [Cytophaga hutchinsonii ATCC 33406]
Sequence
MIYPSDLESKIGFDQIRELLKTTCKGLAAMNMLEELTPSYDIATIEKELQETDEFKKIIE
SGMLFPDRDFVDITLLANKIQVQGNYLEIEELLQCKLFLTTLIACQSFFKRTETDIYVRL
QERANAVKIDSSLFKAINRVIDDHGVIRDTASDELRMIREEYREEQIKLRKEVDRLLRVF
KKEGYTVEDTEATIRSGRLVLPVLAEYKRKVQGIIHDESGTGQTVFMEPISLLPYNNSVR
ELEIRERKEIVRILMQLTDYIRPFAEVMLEANQLVGWFDFIRAKATFACSVNGVMPGLQK
RPLIKWRNARHPLLWLKNKKIKKEVMPLSIQVDEQNRILLLSGPNAGGKSVCMKTLGLLQ
YMLQCGLLIPVEEGSVSGVFENFFIDIGDSQSLDNDLSTYSSHIKNLTFFLEHADAKTLL
LIDEFGSGTDPMYGSAIAEAALEKLNERKSMGIITTHYAGLKALASKTEGLINGSMRFDT
DKLIPLYILDIGVPGSSFTLEIAEKSGLAKSLIEQARTKLDQEQVDLSTLLRDIERERTT
LQQEILSGRELKVKHEKLSKEFEEKLAELQDKRRRLLLEAKEEAYRIVQKADGKAEELIR
SISNAKDKHGAQKHRQEIREVGKALEKELEPEINIADNESIRYDWKTGDIVRIRSNGAVG
KIEAVKGKLAELFIGDLKATVHFSELSSASAKELKAKTDERRPKAGGVDLVQKHQIFSMQ
LDLRGKRTEEAIAFTDRWINDAFILGIEEARILHGKGDGILRKMLREHLKQYKQIVAMND
EHIDSGGAGITVLSMRY
Download sequence
Identical sequences Q11RR4
WP_011586010.1.19587 WP_011586010.1.79486 ChR87 269798.CHU_2648 gi|110639033|ref|YP_679242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]