SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110639129|ref|YP_679338.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110639129|ref|YP_679338.1|
Domain Number 1 Region: 221-592
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.14e-74
Family beta-Lactamase/D-ala carboxypeptidase 0.001
Further Details:      
 
Domain Number 2 Region: 54-233
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.49e-25
Family Penicillin binding protein dimerisation domain 0.0055
Further Details:      
 
Domain Number 3 Region: 648-701
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000118
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110639129|ref|YP_679338.1|
Sequence length 701
Comment cell division protein, penicillin-binding protein [Cytophaga hutchinsonii ATCC 33406]
Sequence
MNIKKSIVLRIRLAFLVILLFSFAIGYKIVVIQFVQGDRWAKLHEENLLDFKDVKPTRGN
IFSDDGSLLATSLPFYRVCIDPKVADDEIYRKGIDQLSRNLANYFKDKTASEYKRKINDA
RKGNKRYIILNHKLINYQAKKEMSEWPIFSEGRSKGGIVFEKVDKRFLPFSFLAQRTVGF
VNEDNNGAGLEYSFNKELAGQNGKALFRKMSGGNWKPVHDENEIMPVDGIDIVTTIDVNI
QDVAEASLRNHLTAHDADYGCVVLMEVATGEIKAIANLGKIGEGAYAENYNYAMGNQGLT
EPGSTFKLASMIALFEDTDINLADTIDTGNGEYEFYDRIMRDSKPGGYGKITLQHAFETS
SNIAVSKKVNEYFGAKPDKFLEYITKMGLTEPVVFQMDGVAKPYFKTTASKTWSGTTLPW
MSIGYELSMSPIHTLAFYNAVANNGKMVRPMIVKETRVADQVLDRYETEVVEEKICSDET
IRKVKIMLEGVVENGTAANIKNSNYKIGGKTGTAQRLVKQTYTRTYYTSFVGYFPADRPK
YSCIVVIDNPKGYNLYGSDVAAPVFKEVADKIFAQDLDLHAPIAPNNVTAFSGIFPAIKG
GLYEDLKFLCNELKIPQHTSTNANDDWVKANLENKTVVWYDRKIVAGIVPDVNGLRLKDA
LYILENIGLRVRFEGSGRVVSQSIQSGTRYNKGNYITIVLN
Download sequence
Identical sequences Q11RG8
gi|110639129|ref|YP_679338.1| 269798.CHU_2746 WP_011586106.1.19587 WP_011586106.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]