SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110638312|ref|YP_678521.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110638312|ref|YP_678521.1|
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.33e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110638312|ref|YP_678521.1|
Sequence length 127
Comment anti-anti-sigma regulatory factor [Cytophaga hutchinsonii ATCC 33406]
Sequence
MKYTVEKTEKYVLFQLHEEKLTSITAPDLKTELVTLNAEGFNNIILNMTDVKYADSSGLS
SILIGNRVCNNSGGLFVMCNVNDHVMKLLKISQLDTILTLLPTVEEGIDAVFLHEIQGDL
EDEESAE
Download sequence
Identical sequences Q11TT5
269798.CHU_1913 gi|110638312|ref|YP_678521.1| WP_011585296.1.19587 WP_011585296.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]