SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110638451|ref|YP_678660.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110638451|ref|YP_678660.1|
Domain Number 1 Region: 61-295
Classification Level Classification E-value
Superfamily L domain-like 9.86e-43
Family Internalin LRR domain 0.0047
Further Details:      
 
Domain Number 2 Region: 311-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000116
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110638451|ref|YP_678660.1|
Sequence length 565
Comment leucine-rich repeat-containing protein [Cytophaga hutchinsonii ATCC 33406]
Sequence
MLKKITCYTVLYIFILLNQPIQAQTYVIPDANFKNYLALNIPYVLNSNQELIISNAKIFT
GTINCVGMNIEDLSGLQYFYKLTQLNCNSNQLTFLPSLDSLKQLQHMWVYNNKLTSIPSV
NQLTNLQTLNVKNNQLTNLPSLTGMTALKSLDCSSNKLTALPDLSTLLNLEEMYCYINFI
TNIPSVSNLLHLKIFNIENNAIALLPDISQNTKLEILQFDLNQIETIPPLTTLTALKQLI
FAHNKISTLPDLSANTALFIITGDNNQLTHIPDLSGFDNLTHVELSHNQLTFEDILPSSK
HPQFSTVFNIQPQDSLNVNQPVSAVKGSTITLPLQFDLAVSGSTYNWYKNNIYLSSTTIP
VLTLSNITEMNAGRYTCIITNNTSRLTGITLHARSYSILVEPCIKFSYINYEITANDCSK
GAAIQIDHTQISALNTPLTYALHPLNNQSSITSASAVLNDVMPGRYSLTISDVNNCSVEL
QNYIFIPVPAGCMDSFTPNGDGLEDTYLIDKPGYTKIYNKNGTLIRTLNTPAAWDGSDES
GKLCPMGYYIIIIDGKEKTGVVLIN
Download sequence
Identical sequences Q11TE6
269798.CHU_2055 ChR138 gi|110638451|ref|YP_678660.1| WP_011585435.1.19587 WP_011585435.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]