SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125623271|ref|YP_001031754.1| from Lactococcus lactis subsp. cremoris MG1363

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125623271|ref|YP_001031754.1|
Domain Number 1 Region: 2-80,173-349
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.99e-59
Family Bacterial dinuclear zinc exopeptidases 0.0000524
Further Details:      
 
Domain Number 2 Region: 70-181
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.59e-24
Family Aminopeptidase/glucanase lid domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125623271|ref|YP_001031754.1|
Sequence length 355
Comment glutamyl-aminopeptidase [Lactococcus lactis subsp. cremoris MG1363]
Sequence
MELFDKVKALTEIQATSGFEGPVRDYLKARMVELGYQPEFDGLGGIFVTKASKVENAPRI
MVAAHMDEVGFMVSSIKADGTFRVVPLGGWNPLVVSGQRFTLFTRTGKKIPVVTGGLPPH
LLRGTGVTPQIPAISDIIFDGAFENAAEAAEFGIAQGDLIIPETETILSANGKNIISKAW
DNRYGCLMILELLEFLADKELPVTLIIGANVQEEVGLRGAKVSTTKFNPDLFFAVDCSPA
SDTFGDDNGRLGEGTTLRFFDPGHIMLPGMKNFLLDTANHAKVKTQVYMAKGGTDAGAAH
LANGGVPSTTIGVVARYIHSHQTIFNIDDFLQAQTFLRAIITSLNTEKVAEIKNY
Download sequence
Identical sequences A0A165FUR9 Q48677
gi|125623271|ref|YP_001031754.1| gi|389853599|ref|YP_006355843.1| 416870.llmg_0403 WP_011834455.1.100658 WP_011834455.1.31408 WP_011834455.1.33726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]