SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225848490|ref|YP_002728653.1| from Sulfurihydrogenibium azorense Az-Fu1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225848490|ref|YP_002728653.1|
Domain Number 1 Region: 2-376
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.09e-103
Family Homocysteine S-methyltransferase 0.00000509
Further Details:      
 
Domain Number 2 Region: 334-601
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 2.09e-76
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00027
Further Details:      
 
Domain Number 3 Region: 874-1176
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.7e-63
Family Methionine synthase SAM-binding domain 0.0077
Further Details:      
 
Domain Number 4 Region: 712-840
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 4.06e-39
Family Cobalamin (vitamin B12)-binding domain 0.0000796
Further Details:      
 
Domain Number 5 Region: 625-708
Classification Level Classification E-value
Superfamily Methionine synthase domain 4.97e-22
Family Methionine synthase domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225848490|ref|YP_002728653.1|
Sequence length 1176
Comment methionine synthase [Sulfurihydrogenibium azorense Az-Fu1]
Sequence
MDLRSLIKERVLVIDGAMGTMIQSTIIPMSAWDGKVGCNEILNITAPQIIQNIHEKYLQA
GADIIKTNTFGALPWVLEEYGIPDKAYELAKAGALLVKQLCDKYSTAEKPRFVAGSLGPG
TKLPSLGHIDYDTMYEGYKVAAYGLIDGGVDVFLVETCQDPLQIKVALHALNDASKERRK
DIPIMVSATIELTGTMLIGTDAQTLAAIMEPFDILTLGFNCGTGPDQVEQHLRKLSQVWK
GYISVHANAGLPENRGGQTYYPMNAEEFAEKESKFLDIDGVAIVGGCCGTTPSHIKALYE
KVKGKKPKKPVGKQPKSLASLFMTQPLKQDPPPFLVGERTNATGSKQFRELLLKEDYDGI
LAIAQDQVKSGSHALDVSVNYAGRDEIKDMKEVIRRFNEKIPIPLMVDSTQPKAIEAGLK
HIGGKPIINSANLEDSEEKFDKICQLAKRFGTSLVLLAIDEQGMAKTKERKLEVAERMYE
RATKVHGLDPEDLVFDLLTFTVGSGDQEYRDAAVQTIEAIRELRKRHPEVGAVLGISNVS
FGLDMHARKYLNSVFLHHCVEAGLTMAIVNPKHLIPFHKISEEDRKVCENLLFNVWENGK
DPLFEFIHYFSKKKESILSEESKDFKNLPIEEKIKKLLIDGEKEKLIKAVEEARHKIPPE
KIINEILIDAMKIVGDLFGEGKMQLPFVLQSAESMKAAVDYLNQFLPKTTKKKKTTLVLG
TVKGDVHDVGKNLVDIILTNNGFNVVNLGIKVELEQFLKAAEEHKADAIGMSGLLVKSTL
EMKNNLEEMQKRGIKIPVLLGGAALNKKFVDEYCRPVYDGPIFYCRDAFDGIEAMTRIEK
GIFDTDLGYKEEEETQVKIEEKLEIPPLKDIKMPSMDVVVPTPPFWGRKVWIHPDSPEYE
EIRELAFRWINKGALFKRAWGYTRGDKSREEYEKLKKEEILPNFERLKKLLIENDLFNPI
IIYGYYPCRSDFPIRLKNNDNRESSLLIFPPSEGWKSEEDVNREPLENILDRVYKKIDFP
RSSKPPYRSLSDYFHHDRHDVVAFTVVSAGKKLSEYENELFKQGKYKDYHLIHGLGVELA
EALAEIVHKKIRIELGIAKAEGESLYDVNWQIRNYQGARYSPGYPACPDLAINDIIFDIL
KPQEYGITLTENHLIVPEQSTDAIVVYHPEATYFSV
Download sequence
Identical sequences C1DU66
WP_012674314.1.69036 204536.SULAZ_0668 gi|225848490|ref|YP_002728653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]