SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225848595|ref|YP_002728758.1| from Sulfurihydrogenibium azorense Az-Fu1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225848595|ref|YP_002728758.1|
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.35e-108
Family Methylenetetrahydrofolate reductase 0.0000000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225848595|ref|YP_002728758.1|
Sequence length 291
Comment 5,10-methylenetetrahydrofolate reductase [Sulfurihydrogenibium azorense Az-Fu1]
Sequence
MKIVDKLKKEKVSISFEFFPPKTKELEDSLFKTIEELKPINPTFVSVTYGAGGSTREKTR
DIVKKIHEETNLTVMAHLTCVGHSKQEIKQILEDYKNIGIENILALRGDIPLSFDKKDIP
LDGCKHAFELVSLIKDNFGDYFCIAVASYPEGHPESPNLERDIYYFKQKVEAGADFSITQ
MFFDNSYFYDFLDRCTKAGVNIPIIPGIMPITNFNQIRKFASLCGATIPEDVVKLFEKYA
DNPEETKKIGIEFATKQCEDLLKNGVKGLHFYTLNKSDATIKIYNNIKALL
Download sequence
Identical sequences C1DUH1
204536.SULAZ_0776 gi|225848595|ref|YP_002728758.1| WP_012674867.1.69036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]