SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225849409|ref|YP_002729573.1| from Sulfurihydrogenibium azorense Az-Fu1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849409|ref|YP_002729573.1|
Domain Number 1 Region: 2-209
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.28e-53
Family PP-loop ATPase 0.00000381
Further Details:      
 
Domain Number 2 Region: 368-444
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.45e-22
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0081
Further Details:      
 
Domain Number 3 Region: 213-312
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000051
Family MesJ substrate recognition domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225849409|ref|YP_002729573.1|
Sequence length 454
Comment tRNA(Ile)-lysidine synthase [Sulfurihydrogenibium azorense Az-Fu1]
Sequence
MIEKKFLKAVKDFSLIQPKDKILIAFSGGPDSVVLSFLLKKFQAYFKIEKISLAHLNHSL
REESDKDEEFCKDFGQKYDIPVFVKKVDVKSVAKKEKKSIEEAGREERYKFFKEIMEKEN
FNKLATAHHLSDLIETMFLWFVQGNKKGLKGFKPNEENIIRPLYYIKKEELLEYCHKNDL
SYVIDKSNFDKRYLRNKVRLDLIPIAKEINHSLEESLLRLSFFQSVDEDFLEIYSKDILK
SLQEKDYIDLNYLNTLHEAVKYRVITNWIYEKTRIYPSYQKMLNILKLLKMGGTKALHLQ
ENLQLIKEYDKLYLNYTQKVEKSYKEYKLKIGQTIFIKEQGISLTAFKPTEKDLEEMKKS
KCIECFDIDTDEFTVRFRKEGDRFLPFGMKREKKLKDVFIDLKIPKNMRNSIPLLVFGDK
ILWIVGYKRSAYYPVTENSQNLICFKVKEEQNCN
Download sequence
Identical sequences C1DWT6
gi|225849409|ref|YP_002729573.1| 204536.SULAZ_1609 WP_012673999.1.69036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]