SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221234574|ref|YP_002517010.1| from Caulobacter crescentus NA1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221234574|ref|YP_002517010.1|
Domain Number 1 Region: 41-485
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.44e-152
Family Type II DNA topoisomerase 0.00000000708
Further Details:      
 
Domain Number 2 Region: 523-755
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 5.23e-48
Family GyrA/ParC C-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221234574|ref|YP_002517010.1|
Sequence length 759
Comment topoisomerase IV subunit A [Caulobacter crescentus NA1000]
Sequence
MNKPVLPPPGGPDDGDRILDEPLTEALSRRYLAYALSTIGSRALPDVRDGLKPVHRRVLY
AMSNMRLNPDAAARKCAKVVGEVMGNFHPHGDASIYDALVRLAQEFSQRIPLVEGQGNFG
NIDGDSAAAMRYTECKMTEAAMLLLDGIDEDAVDFRPTYDGQDEEPVVLPSGFPNLLANG
SSGIAVGMATSIPPHNAAELIDACQLLLANPDATTADLLEKVPGPDFPTGGVIVESRASL
LETYETGRGGVRMRAKWEKEDTGRGTYQIVVTEIPYQVKKSDLVEQLADLIDSKKAALLG
DVRDESAEDIRLVLEPKSKNVEPEVLMESLFKLSALESRFPVNINVLDARGTPGVMGIKQ
ALMAFLAHRREVLTRRARHRLAKIEARLHILDGLLIAYLNLDEVIRIVRYEDKPKEKLIE
TFGLTDIQADAILNTRLRQLAKLEEMEIRREHAELVEERDGILAMLASEAKQWKLVGVGL
SEVRAALLKIKHPLDKPRPTGVTGRSVFGEAPQVDADAAIEAMIVREPITIILSERGWIR
AAKGKIDDPSELKFKEGDKLGFLVPAETTDKLLIFSSDGRFFTLGCDKLPSARGHGEPVR
MMIELDDKVKIIDVFPFKAGRKRILASKGGYGFLMPEEEALANRKAGKQVLNVGNEGAAF
CLEAVGDQLAVIGDNGKILIFPLEELPEMPRGKGVKLQAYREGGLRDGLSFNAETGAYWI
DTAGRRRDWAEWKEWVGRRAGAGKLVPKGFATNKRFRPK
Download sequence
Identical sequences A0A0H3C8F5 O54478
gi|16125813|ref|NP_420377.1| NP_420377.1.61804 YP_002517010.1.80956 gi|221234574|ref|YP_002517010.1| 190650.CC_1566 565050.CCNA_01637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]