SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221234588|ref|YP_002517024.1| from Caulobacter crescentus NA1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221234588|ref|YP_002517024.1|
Domain Number 1 Region: 39-522
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 5.62e-171
Family Type II DNA topoisomerase 0.000000000162
Further Details:      
 
Domain Number 2 Region: 533-744,801-911
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.22e-93
Family GyrA/ParC C-terminal domain-like 0.0000891
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221234588|ref|YP_002517024.1|
Sequence length 919
Comment DNA gyrase subunit A [Caulobacter crescentus NA1000]
Sequence
MSDDHNTIPADGSRGDIAPINIEDELRRSYLDYAMSVIVSRALPDARDGLKPVHRRVLFS
MHEQGQTPERPYVKSARVVGDVMGKYHPHGDASIYFTLVRMTQSFSMGLVLIDGQGNFGS
VDGDMPAAMRYTECRMAPPAMALLADLDKDTVDFADNYDGKEQEPTVLPSRIPNLLVNGA
GGIAVGMATNIPPHNLGEVIDACLLLIDQPDVTTDQLLDLVPGPDFPTGGEIIGRAGPRQ
ALLTGRGSVIMRGVASVEELRAGREAIIVTEIPYQVNKANLVEHIAELVRDKKIEGVADI
RDESNRDGMRIVVELKRDASGEVILNQLYRFTALQSSFGVNMLALNRGRPEQMGLHQLIQ
LFVDFREEVVVRRTKFELGKARDRGHVLVGLTIAVANIDEFIHIIRSSKDPTEARERLVA
KSWPAGDMLPLVELIADPRTVQEDGGLIRLTDEQARAILALTLSRLTGLGRDEIGNEAAA
LADAIRGYLELLSDRANIMAVVREELVEVREKFAIPRRCQIVDGDADMEDEDLIVREDMV
ITVTMGGYVKRTPLANYRTQHRGGKGKSGMATKNEDAVTRVFSASTHAPLLFFTSGGKVY
KMKVWRLPLGVANSRGKAFVNLLPIEPGETITSILALPEDEATWGGLDVMFATRSGSVRR
NKLSDFVDVRRNGKIAMKLDEGDGIVGVAVCNADQDVLLTTAAGRCIRFSVDEVRVFASR
DSTGVRGVKLLDGDQVISMAVLRSVDATPAERAAYLKHQRAMLRAADGEEGEDTATAADD
GDEEVGEASLTPERIAELGAAEEILLTVSSEGFGKRTSAYDFRRTGRGGQGLAAQDLSKR
GGRLVGSFPIDESDQILLVTDQGQLIRVPVSQIRVAARNTQGVTIFRTAQDEHVVSVERL
ADSGGDDNQGEDSGADETP
Download sequence
Identical sequences A0A0H3C8L4 Q9A7Y8
NP_420391.1.61804 YP_002517024.1.80956 gi|16125827|ref|NP_420391.1| gi|221234588|ref|YP_002517024.1| 190650.CC_1580 565050.CCNA_01651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]