SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|367465530|ref|YP_002515534.3| from Caulobacter crescentus NA1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|367465530|ref|YP_002515534.3|
Domain Number 1 Region: 411-577,732-799
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 4.45e-85
Family Type II DNA topoisomerase 0.00068
Further Details:      
 
Domain Number 2 Region: 9-224
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-67
Family DNA gyrase/MutL, N-terminal domain 0.000000604
Further Details:      
 
Domain Number 3 Region: 238-408
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-56
Family DNA gyrase/MutL, second domain 0.00000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|367465530|ref|YP_002515534.3|
Sequence length 805
Comment DNA gyrase subunit B [Caulobacter crescentus NA1000]
Sequence
MTTEEAAAQYGADSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVYEVVDNAIDEALAGH
ATKVQVILNADGSVTVTDDGRGIPVDMHEGEGVSAAEVIMTQLHAGGKFDQNSYKVSGGL
HGVGVSVVNALSDWLELLIHRNGKVHQMRFERGDAVTSLKVTGDSPVRTEGPKAGETLTG
TEVTFFPSKDTFAFIEFDRKTLEHRLRELAFLNSGVTIWFKDHRDVEPWEEKLFYEGGIE
AFVRHLDKAKTPLLKAPIAVKGVKDKVEIDLALWWNDSYHEQMLCFTNNIPQRDGGTHLS
AFRAALTRIITSYAESSGILKKEKVSLGGEDSREGLTCVLSVKVPDPKFSSQTKDKLVSS
EVRPAVEGLVSEGLSTWFEEHPNEAKAIVTKIAEAAAAREAARKARELTRRKSALDITSL
PGKLADCSERDPAKSEIFIVEGDSAGGSAKQARNRDNQAVLPLRGKILNVERARFDKMLS
SDQIGTLITALGAGIGRDDFNPDKVRYHKIVLMTDADVDGAHIRTLLLTFFYRQMPELIE
RGYIYIAQPPLYKASKGKSSRYLKDDAEMDAFLVDEGVDGAELDLASGERMTGQDLLALV
QTCRSAKANIDRLAARAPATAIEQAALSGLLGESPNAAAAATRLDLYAEEGDGPWSGERG
DTGFVFSRVRRGVSERVVLDDVLLHAADARRLAERAVKLTEIFSGRAIFRRKDKSTTVRG
PLDLVNAVLDAGRKGLTIQRYKGLGEMNPDQLWETTLDAEARTLLQVRVNHADDADDMFS
RLMGDLVEPRREFIQENALDAEVDV
Download sequence
Identical sequences B8GXQ0 P0CAX1
NP_418979.1.61804 gi|16124415|ref|NP_418979.1| 190650.CC_0160 565050.CCNA_00159 gi|367465530|ref|YP_002515534.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]