SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221234989|ref|YP_002517425.1| from Caulobacter crescentus NA1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221234989|ref|YP_002517425.1|
Domain Number 1 Region: 454-686
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 9.94e-76
Family Type II DNA topoisomerase 0.0005
Further Details:      
 
Domain Number 2 Region: 55-260
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-60
Family DNA gyrase/MutL, N-terminal domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 277-451
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.03e-42
Family DNA gyrase/MutL, second domain 0.0000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221234989|ref|YP_002517425.1|
Sequence length 695
Comment topoisomerase IV subunit B [Caulobacter crescentus NA1000]
Sequence
MSSSDKIPSLFGDDDALAPVPAAPFKASVEPRVEPTPRPIPPPPPSKTASAPGEYSAADI
EVLEGLEPVRKRPGMYIGGTDERALHHLFAEVLDNSMDEAVAGFAKTIEVKLDADGFLSV
KDDGRGMPVDPHPKYPGKSALEVIMTVLHAGGKFTGKAYETSGGLHGVGASVVNALSERV
EVTVWRDGFEHLQVFSRGKPLGPIQQVAPSKKKGTMVRFKPDDEIFGEGTNFKPARLYRM
ARSKAYLFRGVQIKWSCDPSRIHDQTPPEATFHFPNGLADFLAERTKGLTTITPESFAGR
IERQGEAGAVEWAVTWTPQGFGEHDGFMQSYCNTVPTPEGGTHESGFRAALTRGLKAYAE
LKGEKRGTIITADDVVAQAGALISVFIKNPEFQGQTKEKLSTSEAQRFVEASLRDPFDLW
LSSSPKNAQALLEFVIERAEERLKRRKDKEVSRASATRKLRLPGKLADCAGSAVDGAELF
IVEGDSAGGSAKQARDRKYQAILPLRGKILNVASASGEKFTANKELSDLMLALGAQAGAK
YREEDLRYERIIIMTDADVDGAHIASLLITFFYRTMPELIRGGHLFLALPPLYRLAHGGK
SEYARDDAHKEELLATVFKGKKPEIGRFKGLGEMMASQLKETTMDPKKRTLARVTLPRHE
ESVEDLVETLMGRKPELRFRFIQENAEFASADLDL
Download sequence
Identical sequences A0A0H3C9E0 O54479
gi|16126217|ref|NP_420781.1| 190650.CC_1974 565050.CCNA_02052 NP_420781.1.61804 YP_002517425.1.80956 gi|221234989|ref|YP_002517425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]