SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256371026|ref|YP_003108850.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256371026|ref|YP_003108850.1|
Domain Number 1 Region: 111-459
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.000000000000126
Family Phase 1 flagellin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256371026|ref|YP_003108850.1|
Sequence length 462
Comment flagellar hook-associated protein FlgK [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MSGGALYIALSGLEAQQVGLDVVAQNVANANTPGYQSESVDLANQQLPGSPVGDGVTVQG
VLQAQNTFARSLELGSQAASSYATQLSSTLTAAQSGSFQEPSSTGISEQLNGLWSAFGQL
SDTPTQLASAQSVVAAAQQVAEALNQAASNLTGLFNDTSQQASLLVAQVNTQLAQVASLN
GQIAAQSGGEVGAANSLIDARNQVLSQLANEIGATVVPASSQQVNVLVGGVTLVQGTQSN
ALAAAIAAPGSPPTASGTAQILLAGTSTQVPVTSGSLGGMLASLNNNLPRYGTQLNATAQ
ALATQVNGLLASGQTQGTTGPIAGPPLFVAAGGGTLDAGSIAVNPQIEASPSLLAASTTP
YAGGNGQNAAAIANLGSAADGPNALWSQAVGQVGLDVQSATSLATSAAQQAQSAQTAEQS
SVGVDVNGQLVNLVTYQQAYQAAAKVISTVQQALSSLLSSVS
Download sequence
Identical sequences C7M279
525909.Afer_0208 WP_015797682.1.72805 gi|256371026|ref|YP_003108850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]