SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256371032|ref|YP_003108856.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256371032|ref|YP_003108856.1|
Domain Number 1 Region: 203-391
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.09e-49
Family Methylesterase CheB, C-terminal domain 0.0000673
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 4.13e-27
Family CheY-related 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256371032|ref|YP_003108856.1|
Sequence length 394
Comment response regulator receiver modulated CheB methylesterase [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MRSLLVVDDSGVVRMMVRRWLLEACRDLEVVEASGGRAALELLEQRTVDLILLDVEMPDL
DGLSVVRTLRVRGVRTPVVMFSTLTSRGTDVAVAALLAGASDVIAKPQASNQGAGRQALV
ERVCSLLAAEEELIVAAATQGVPASARVVEPATPRVGAGAPRIAHRVPWQAPAMRTSPTP
RRQEVPTHRAAPPLTVLRPRRPQAPGLVVVASSTGGPQALASFLAGLGRVAVPTVCVQHM
PASFLPLLAARLAEQLGSDVALAEDGEVARAGTVRLAAGGRHLIVTADRPDGSLRLGYVD
QPPENSCRPSADVLFRSAAATGVRAMAVVLTGMGADGAKGAAAVAEAGGVVAIQDAASAV
VWGMPGAVDALGVASVVAPPAELGDRVRRLVGMP
Download sequence
Identical sequences C7M285
525909.Afer_0214 WP_015797688.1.72805 gi|256371032|ref|YP_003108856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]