SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256371232|ref|YP_003109056.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256371232|ref|YP_003109056.1|
Domain Number 1 Region: 74-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-24
Family Translational machinery components 0.00024
Further Details:      
 
Domain Number 2 Region: 3-71
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.36e-20
Family Ribosomal S5 protein, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256371232|ref|YP_003109056.1|
Sequence length 183
Comment 30S ribosomal protein S5 [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MATNEFEDRTIKVNRVSKVVKGGRRFSFTALMVVGDHAGQVGLGYGKAKEASLAVQKGVD
EAKRKLVRVPLVHGTIPHAVVGVAGAGRVLLKPAAPGTGVIAGGAARAILELAGVTDVLA
KSLGSSNGINVAYATLAGLEALLSPQRIAEARGRYVDQVAPRWLIEESPARVDGEVVEVG
ADG
Download sequence
Identical sequences C7M2Y9
525909.Afer_0415 gi|256371232|ref|YP_003109056.1| WP_015797884.1.72805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]