SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256371277|ref|YP_003109101.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256371277|ref|YP_003109101.1|
Domain Number 1 Region: 188-437
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.07e-53
Family N-type ATP pyrophosphatases 0.0000054
Further Details:      
 
Domain Number 2 Region: 8-231
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.15e-49
Family Class I glutamine amidotransferases (GAT) 0.0000365
Further Details:      
 
Domain Number 3 Region: 396-517
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 6.15e-48
Family GMP synthetase C-terminal dimerisation domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256371277|ref|YP_003109101.1|
Sequence length 517
Comment GMP synthase, large subunit [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MRHADEQVVLVVDFGAQYAQLIARRVRELHVYSEVVPARDALAFVRSRRPAAVILSGGPA
SVYAPGAPGLAPEVLEANVPILGICYGAQLMAQQLGGVVEHGGSGEYGRTVIERTDERAH
LLPPLRGEAPETVWMSHADAIVAPPEGARVVASSAGAPVAAFEDPARRRFGVQWHPEVSH
TPGGMELLGRFLFDVVGLEPRWTSFSIIEQAIAEVRSTVGDGRAICALSGGVDSTVAAAL
TAEAIGDRLTCVFVDTGLLRSGEAEQVEHLFRSQFDIELIVVDAADRFFDALAGVTDPEA
KRKIIGELFIRIFEETAASKTNATHLVQGTLYPDIVESGSDGSATIKSHHNVGGLPDDVA
FTIVEPLRRLFKDEVRRIGVELGIPESFVWRQPFPGPGIAVRVLGEVTAERVETVRRADR
IVQDELDEAGLSRSLWQAFAVLAPGLRSVGVSGDARTYDAPVIVRAVESEDAMTADWARL
PWEVLDRISRRIVNEVPGVNRVVYDVTSKPPGTIEWE
Download sequence
Identical sequences C7M334
525909.Afer_0460 WP_015797927.1.72805 gi|256371277|ref|YP_003109101.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]