SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256371446|ref|YP_003109270.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256371446|ref|YP_003109270.1|
Domain Number 1 Region: 316-508
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.89e-46
Family Ribonuclease PH domain 1-like 0.00000695
Further Details:      
 
Domain Number 2 Region: 17-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.01e-44
Family Ribonuclease PH domain 1-like 0.00000723
Further Details:      
 
Domain Number 3 Region: 471-569
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.14e-24
Family Ribonuclease PH domain 2-like 0.0000331
Further Details:      
 
Domain Number 4 Region: 250-347
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.14e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00096
Further Details:      
 
Domain Number 5 Region: 146-248
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.14e-17
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 6 Region: 576-666
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.6e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 7 Region: 647-716
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.31e-16
Family Cold shock DNA-binding domain-like 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256371446|ref|YP_003109270.1|
Sequence length 792
Comment polyribonucleotide nucleotidyltransferase [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MSFISVERQLTGVPSPLRFETGKLALQANGAVVARLGGTTVLVTATGAKHVREGIDFFPL
TVDVEERMYAAGKIPGSFFRREGRATDQAILTARLIDRPLRPSFADGFRNEVHVVATVLG
ADLVNPHDVLAINAASAALMVSGLPFEGPIGAVRVALAADGSWIPFPTFQQGDASSFELV
VAGRKTSDGTDIAIMMVEAGGTEATWGAFEANAAIPTEATVAEGLVAAKQWIRESIELQE
ELVAKLDHRPTFAWTPMRDYEEDVLVRVNEVGRERLAAANAHTDKVTRQDALDAAGDAIW
AELADEFPEREREVRAAIRRVTKEIVRERITREGVRIDGRDTTTIRPLLIEVGLIPTAHG
SGLFQRGETQVLNICTLGMPRMNQQLDTLGVDEEKRYMHHYNMPPFATGETGFMRGPKRR
EIGHGLLAERALVPVLPPESEFPYALRLVSEVLSSNGSTSMASVCGSTLSLMDAGVPIRA
AVGGIAMGLIAHDGVYTTLTDILGAEDAFGDMDFKVAGTREFVTALQLDTKIDGIPSEVL
AAALEQARQARVSILDQMLAVIPAPRSEVAETAPRLITFQVPLDKVGEIIGPKGKTINTL
QQETGADVSIDDDGVVGTVVIGARDIEAAREAERRIQLILNPPQATLGEVYEGKVVGMTK
FGAFVNVLPGKDGLVHISKLGRGKRVERVEDVLEMGQVLKVRVDDIDPSGKLSLSIVDDE
NGETPAHAGASHAGSSHAGASRTSGREGSDRRHRRDERPGNDRRGSSSAPANAVSFEDRF
ESEIQRELGDLQ
Download sequence
Identical sequences C7LXY9
gi|256371446|ref|YP_003109270.1| 525909.Afer_0643 WP_015798092.1.72805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]