SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256371521|ref|YP_003109345.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256371521|ref|YP_003109345.1|
Domain Number 1 Region: 11-176
Classification Level Classification E-value
Superfamily Cobalamin adenosyltransferase-like 5.3e-43
Family Cobalamin adenosyltransferase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256371521|ref|YP_003109345.1|
Sequence length 189
Comment ATP/cobalamin adenosyltransferase [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MEGAARRRTPIYTRRGDGGTTGMLYGGRLPKDHPQVELNGAVDETQAQLGVVRASAAVDL
ATICLDLERDLWVLMAEVATLPEHRSKLVPGETLVTKAMVERLERLIDDVSERFEPIRDF
VVPGGTPTAAALDVARTVCRRAERLAVRFVASAPSSHVGAYLNRLSDALWTLARWQEGMH
LRAKDVGVE
Download sequence
Identical sequences C7LY64
525909.Afer_0722 gi|256371521|ref|YP_003109345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]