SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256372250|ref|YP_003110074.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256372250|ref|YP_003110074.1|
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily CsrA-like 0.00000000000000602
Family CsrA-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256372250|ref|YP_003110074.1|
Sequence length 117
Comment carbon storage regulator CsrA [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MLVLARKLGQSIVIGDDIVVTVLAIDPYGGVRLGIVAPRDVRIVRDELLKAIATENEAAA
RSATTAGLEGVAEPRRNRHELSRLESRVSQPEPDRDGEGPRCTQGSRASTSPGAVLR
Download sequence
Identical sequences C7M093
gi|256372250|ref|YP_003110074.1| 525909.Afer_1478 WP_015798883.1.72805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]