SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256372281|ref|YP_003110105.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256372281|ref|YP_003110105.1|
Domain Number 1 Region: 11-147
Classification Level Classification E-value
Superfamily RNase III domain-like 7.85e-33
Family RNase III catalytic domain-like 0.00051
Further Details:      
 
Domain Number 2 Region: 112-221
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.05e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256372281|ref|YP_003110105.1|
Sequence length 263
Comment ribonuclease III [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MSRAKRRERSILELIPAALRDHPVVRQALVHKSASRDPLDSNERLEFLGDAVIELVVSDY
LYRRYPDVDEGRLTQVRSALVSRRSLGSVGVQGGLLEAITVGQADALGPVLAANAVEALA
GAVYLAGGFQLSVAFVLAILGPSLERVDGDLVLGDYKSLLHQALAKLHHQPPRYKVSWSG
PDHDRRYRVVVQLPGGFEAAGEGASRKEAEQEACRLAILEANRRAEAAGLAQATTEAPSR
PPRRRSSRRASPRPSEPERAGGA
Download sequence
Identical sequences C7M0C4
gi|256372281|ref|YP_003110105.1| 525909.Afer_1509 WP_015798911.1.72805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]