SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226350034|ref|YP_002777147.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226350034|ref|YP_002777147.1|
Domain Number 1 Region: 54-187
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000000000199
Family MJ1460-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226350034|ref|YP_002777147.1|
Sequence length 223
Comment putative naphthalene degradation regulatory protein [Rhodococcus opacus B4]
Sequence
MTELSALIARALDDMCEYQERFTRDPGHAQVSLAGIPHALVPTHVVASDLPRELVEILGA
ELAPAVMYRFGRLIGLSHAAAFFADRKIGMTEPQYRVLTGPFHFAWAGYGDVQLLLWEPK
LDEDFLVLWESDNSFSAREALNDGHRSRACHLQAGYAAGWASEATGLPIDVQEIACRAEG
VSYCRFAMAHRDRVSLWMRDPRLHRPTKQYKVMPASMPRAASV
Download sequence
Identical sequences C1BE07
gi|226350034|ref|YP_002777147.1| WP_012687242.1.100430 WP_012687242.1.34288 gi|226350034|ref|YP_002777147.1|NC_012521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]