SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226360041|ref|YP_002777819.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226360041|ref|YP_002777819.1|
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily PEBP-like 3.66e-46
Family Prokaryotic PEBP-like proteins 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226360041|ref|YP_002777819.1|
Sequence length 176
Comment hypothetical protein ROP_06270 [Rhodococcus opacus B4]
Sequence
MSHDPYEALPDLPSFELTSTDVTDGQPLNKEQVSGIFGAGGHDNSPQLSWSGFPAETKSF
AVTVYDPDAPTASGFWHWAVANIPADTTTLVSGAGDDDGTGLPSGAITLKNDAGLSRFLG
AAPPAGHGPHRYIIVVHAVDVEILDGVTADSTPAFLGFNLFSHAIARAKIQGTYEQ
Download sequence
Identical sequences C1ASU2
632772.ROP_06270 gi|226360041|ref|YP_002777819.1| WP_012687879.1.34288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]