SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226362018|ref|YP_002779796.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226362018|ref|YP_002779796.1|
Domain Number 1 Region: 47-357
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 8.77e-78
Family Heme-dependent catalases 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226362018|ref|YP_002779796.1|
Sequence length 373
Comment hypothetical protein ROP_26040 [Rhodococcus opacus B4]
Sequence
MPRTGDGHEPSVGGRSGTTVTRRGALLGLAAVGAIAAADVGGFLFAGGRLTPDTVTPSRF
VDRFEQVFGRHEGFRRNHAKGVSVTGWFTATGAGSAVSTASVFRAGSRHPVTGRFSLSGG
QPDAADAVDTVRGLGLMFRLPGGEQWRTAMIDSPVFPDRTPDGFRARLLASKKVPDTGKP
DPAAMAAFLACHPETAAAMDIIRRQHRTSGFGDSTFHGLNAFRCTDRSGASVPVRWRLVP
EQAVRQPGAEEGSGRDYLFDALVREVTRGPLRWRMILTIGEAGDPTDDATRPWPADRTSL
DVGTLTVDAIDTEGPGNARDVNFDPLVLPNGIAPSDDPLLSARSAVYAESFDRRSGEPKA
PSRVTVAEVPDER
Download sequence
Identical sequences C1B403
WP_012689807.1.34288 gi|226362018|ref|YP_002779796.1| 632772.ROP_26040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]