SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226362147|ref|YP_002779925.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226362147|ref|YP_002779925.1|
Domain Number 1 Region: 5-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.23e-76
Family FMN-linked oxidoreductases 0.000000102
Further Details:      
 
Domain Number 2 Region: 342-555
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.53e-26
Family N-terminal domain of adrenodoxin reductase-like 0.00012
Further Details:      
 
Domain Number 3 Region: 495-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.77e-22
Family C-terminal domain of adrenodoxin reductase-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226362147|ref|YP_002779925.1|
Sequence length 737
Comment methylamine dehydrogenase [Rhodococcus opacus B4]
Sequence
MAPDPRHAPLFEPIRVGNKIFRNRFYVAPHCSGLGVEYPGAQAYLRGMRAEGGWAAVNTE
YCAVDAESDDAPWVQARLIDQRDQANLRLMVERVHQFDALAGVQLVYMGADHTGFVTRLP
AGGPSQVTSSMSGHSCYALDKQDIRRIQRSYVEAAIRARDIGFDLVQIAAREGFSLPLQF
LWKYWNHRTDEYGGSIENRTRFWRETIEQVREAVGDNCAIVAGFCLDSFNDESDRAFKVS
DDGIAVVELLDDMVDLWDMQVGHLEDDVSSSRFFEPFWQRSYIEQVRPYAKKPIAAVGRF
TDPELMARAIKDGVIDIIGAARPAIADPFIPTKIFEGHGDDIRECIGCNICVSRFNNGGG
RIVCTQNATVGEEYRRGWHPEQFNESEMTEEPILIIGAGPAGMECARVLGERGFANVHLV
ERDDHIGGHVSWISELPGLRTWRRVVEYRESQLHKLTNVAVLTGQNLSADDVLDYGASTV
IVATGAEWDPSGANPITHAPIPGADADFVYTPEQIMLDGIEVPGDRVLVYDCDGYFMGSS
IAEKLASEGKTVTLVSPSDQIGSYLFFTDEGGHVHHNLLKLDVELVPSHVVTSIERGLVR
GHNSYHSGKVSEWPVDSVVLVTQRLSRSSLYDELTRSPELLEENGITRVLRIGDCLEPRV
IAESVFDGHRLAREIDTSNPAIPLPFIREQRILGWDADAYDSELTHTLPLEVSSHTTATV
KSPQDRCADAFHSIRHG
Download sequence
Identical sequences C1B554
632772.ROP_27330 gi|226362147|ref|YP_002779925.1| WP_012689936.1.34288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]