SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226363090|ref|YP_002780872.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226363090|ref|YP_002780872.1|
Domain Number 1 Region: 53-553
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 8.64e-197
Family Heme-dependent catalases 0.0000000000655
Further Details:      
 
Domain Number 2 Region: 574-686
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000000101
Family Catalase, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226363090|ref|YP_002780872.1|
Sequence length 715
Comment catalase HPII [Rhodococcus opacus B4]
Sequence
MPKKNPPIPGTPGSGTPAVAEPTEPTEPLPPKSDQQAPALQTATGRPVEGPATARGQQGA
HLTTAQGARLYDTDHSLEAGERGPTLLQDHHLREKITHFDHERIPERVVHARGAAAHGVF
RGYGSAEPISKAAFLAEDVETPVFVRFSTVLGSRGSADAVRDTRGFATKFYTGEGTFDLV
GNNIPVFFIQDGIKFPDIIHAGKPHPDREIPQAQSAHDTFWDFVSLHTEATAHTLWNMSD
RGIPRSYRMMEGFGVNTFRMVNAGGDSSLVKFHWKPKLGVHSLVWEEAQIVNGMDPDYHR
RDLADAIESGTYPQWELGIQAFPDVPEQMFEGIDLLDPTKFVPEELAPVQPIGLMTLNAN
PTNFFAETEQVAFHPGHLVPGIDTTDDPLLQARLFSYLDTQISRLGGPNFGQIPINRPHA
EVNDMLRDGMHQSGVHPGVAPYRPNSLDAGCPFLAGVDTAFVEVPVPMPETTKLRGAPAS
YDDHFSQARLFYASLSAVEQAHVAQAYTFELGKCYERAIKERALGVVANIDPGLCATVAE
GLGLRIPEPTVAYDIAPTPSPALSQVGAEWPLDGRIIGIVADDESDLSEVGDLVEKIGKN
SMVPLVIGPHGGELGSGKNAVPVSRTFLTMRSVEFDAVVVATPTSDPRVLVLLTEAFRHC
KAIGGWATGRPLLDEARIPGDAPGIVIADDASALFDGLTALMKFHRAWERTPISV
Download sequence
Identical sequences C1B8C4
632772.ROP_36800 gi|226363090|ref|YP_002780872.1| WP_012690866.1.34288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]