SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226365408|ref|YP_002783191.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226365408|ref|YP_002783191.1|
Domain Number 1 Region: 3-489
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.26e-197
Family Heme-dependent catalases 0.000000000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226365408|ref|YP_002783191.1|
Sequence length 505
Comment catalase [Rhodococcus opacus B4]
Sequence
MTDQNFTTDDAGIPVTSDEHSLTIGTDGPILLQDHYLIEKMAQFNRERVAERQPHAKGGG
AFGRFEVTEDVSAYTKADLFQPGKKTDLLIRFSSVAGERGSPDTWRDPRGFAIKFYTDQG
NYDMVGNNTPVFFMRDPMKFQDFIRSQKRRADNNLRDHDMQWDFWTLSPESAHQVTWLMG
DRGIPRTWRHMNGYSSHTYMWVNAAGEKFWVKYHFKTDQGIEFFTQHEGDQMAAMDTDYH
TRDLWEHIDGGEYPSWTLNMQIMPFEDADDYRFNPFDLTKVWPHGDYPLIPVGRMTLDRN
PTDYHCEIEQAAFEPSNLVPGIGPSPDKMLVGRLFSYPDAHRYRIGANYKELPVNRPHVP
VRSYSKDGNMRHHNPGDPVYVPNSKGGPHADPSQVGETATWYAAGDMVRSPYAPHKEDDD
WGQAGTMVRDVLDDAGRDRLVDNIVGHLLNGVSEPILAKAFEYWRNVDKTLGDRIADGVS
KKQSETDPKAGEQANPARSSAQAKA
Download sequence
Identical sequences C1AZH5
632772.ROP_59990 gi|226365408|ref|YP_002783191.1| WP_015889734.1.34288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]