SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226360534|ref|YP_002778312.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226360534|ref|YP_002778312.1|
Domain Number 1 Region: 148-282
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.05e-32
Family Flavohemoglobin, C-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 50-150
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.81e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0038
Further Details:      
 
Domain Number 3 Region: 273-374
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.84e-16
Family 2Fe-2S ferredoxin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226360534|ref|YP_002778312.1|
Sequence length 374
Comment NADPH oxidoreductase [Rhodococcus opacus B4]
Sequence
MEEADVSVAHTSRPAEERRFSLLSLFEAMATPHQLDRYLELVTPMVTVRDLRAEVVEVRR
STADTVTLTLRPTRQWRGFRAGQFVQVGVVIDGVRHTRCYSPANAQASTDGLVELTVKAH
PEGLVSQYLHAHASPGLVLDLSQAAGEFTLPSPRPRRLLLVSGGSGITPVLSMLRTLVDE
QHFGSITFLHYAYTENDVAYLDELRALAAANANVSLVLAYTDQETGGHLHGFFGQEHLDA
VAPWYADAETFLCGPPGLMRGVREVYRELGIEDRLHTEEFAPAAAPAEGEAGGAVSFTAS
GVTADNSGKTLLEQAEAAGLHPEYGCRMGICFSCTTVKKSGCTKNVRTGDTDTDPDKAIQ
LCVSVPVGDVALDI
Download sequence
Identical sequences C1AVT7
gi|226360534|ref|YP_002778312.1| 632772.ROP_11200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]